PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G15840.1
Common NameBBX1, CO, F14F8_220, FG
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CO-like
Protein Properties Length: 373aa    MW: 41986.4 Da    PI: 6.9562
Description B-box type zinc finger protein with CCT domain
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G15840.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.91.6e-061660240
     zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                 ++r C+++ ++  + +C+ ++ +lC +C  + H+       H++v
  AT5G15840.1 16 RARPCDTCRSNACTVYCHADSAYLCMSCDAQVHSAnrvasrHKRV 60
                 6789*******9*********************667788888876 PP

2zf-B_box322.6e-1059105242
     zf-B_box   2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                  + r+C+ +e+ ++ + Ce ++  lC  C +e H+       H++vp+
  AT5G15840.1  59 RVRVCESCERAPAAFLCEADDASLCTACDSEVHSAnplarrHQRVPI 105
                  5689*****************************66899999**9997 PP

3CCT66.76.3e-23306348143
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                  Rea++lRY+eKrktRkFeK+irY+sRKa+Ae RpRv+GrF+k+
  AT5G15840.1 306 REARVLRYREKRKTRKFEKTIRYASRKAYAEIRPRVNGRFAKR 348
                  9****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011911.221562IPR000315B-box-type zinc finger
SMARTSM003367.9E-91562IPR000315B-box-type zinc finger
CDDcd000213.32E-81862No hitNo description
PROSITE profilePS5011912.14558105IPR000315B-box-type zinc finger
PfamPF006431.6E-860105IPR000315B-box-type zinc finger
CDDcd000218.05E-1061105No hitNo description
SMARTSM003369.6E-1263105IPR000315B-box-type zinc finger
PROSITE profilePS5101716.281306348IPR010402CCT domain
PfamPF062036.8E-17306348IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009909Biological Processregulation of flower development
GO:0010018Biological Processfar-red light signaling pathway
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MLKQESNDIG SGENNRARPC DTCRSNACTV YCHADSAYLC MSCDAQVHSA NRVASRHKRV  60
RVCESCERAP AAFLCEADDA SLCTACDSEV HSANPLARRH QRVPILPISG NSFSSMTTTH  120
HQSEKTMTDP EKRLVVDQEE GEEGDKDAKE VASWLFPNSD KNNNNQNNGL LFSDEYLNLV  180
DYNSSMDYKF TGEYSQHQQN CSVPQTSYGG DRVVPLKLEE SRGHQCHNQQ NFQFNIKYGS  240
SGTHYNDNGS INHNAYISSM ETGVVPESTA CVTTASHPRT PKGTVEQQPD PASQMITVTQ  300
LSPMDREARV LRYREKRKTR KFEKTIRYAS RKAYAEIRPR VNGRFAKREI EAEEQGFNTM  360
LMYNTGYGIV PSF
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible246525_at0.0
Expression AtlasAT5G15840-
AtGenExpressAT5G15840-
ATTED-IIAT5G15840-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in leaves, shoots and shoot apical meristem. Detected in the vascular tissue of the hypocotyl, the cotyledons and the leaves. Restricted to the protoxylem and phloem in young inflorescence stems and to the phloem only in older inflorescences. Also detected in the vascular tissue of the root. {ECO:0000269|PubMed:15229176}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a protein showing similarities to zinc finger transcription factors, involved in regulation of flowering under long days. Acts upstream of FT and SOC1.
UniProtTranscription factor that acts in the long day flowering pathway and may mediate between the circadian clock and the control of flowering. Plays a role in the regulation of flowering time by acting on 'SUPPRESSOR OF OVEREXPRESSION OF CO1', 'TERMINAL FLOWER 1' and 'FLOWERING LOCUS T'. Also regulates P5CS2 and ACS10 (involved in proline and ethylene biosynthesis, respectively). {ECO:0000269|PubMed:10834834, ECO:0000269|PubMed:11323677, ECO:0000269|PubMed:21950734}.
Function -- GeneRIF ? help Back to Top
  1. CO-derived signal(s), or possibly CO itself, fits the definition of the hypothetical flowering stimulant, florigen.
    [PMID: 15299137]
  2. findings show that FKF1 controls daily CONSTANS expression in part by degrading CYCLING DOF FACTOR 1 (CDF1), a repressor of CONSTANS transcription
    [PMID: 16002617]
  3. Promotes flowering specifically under long days.
    [PMID: 16006578]
  4. inactivation of FT caused down-regulation of SOC1 even in plants overexpressing CO, indicating that FT is required for SOC1 induction by CO
    [PMID: 16183837]
  5. RFI2 represses the expression of CONSTANS.
    [PMID: 16709197]
  6. These data suggest that CO might replace At HAP2 in the HAP complex to form a trimeric CO/At HAP3/At HAP5 complex.
    [PMID: 17138697]
  7. COb was retained for a long period after duplication, but a recent fixation of a detrimental mutation, possibly as an effect of a bottleneck, resulted in its nonfunctionalization in brassica nigra.
    [PMID: 17344804]
  8. The role of clock-associated genes PRR9, PRR7 and PRR5 are involved in activation of CONSTANS and CO-FLOWERING LOCUS T are reported.
    [PMID: 17504813]
  9. Results suggest that COP1 acts as a repressor of flowering by promoting the ubiquitin-mediated proteolysis of CO in darkness, thereby stabilizing CO, activating FT transcription, and inducing flowering.
    [PMID: 18296627]
  10. determines flowering timing with circadian clock.
    [PMID: 18453150]
  11. a positive regulator of floral induction, as an OBF4-interacting protein
    [PMID: 18587275]
  12. regulation of CO by light quality likely plays a key role in the regulation of flowering time in natural environments
    [PMID: 18667727]
  13. A quantitative balance between the activator CO and the repressor TEMPRANILLO genes determines Flowering locus T levels.
    [PMID: 18718758]
  14. Data suggest that antagonism between GIGANTEA and DOF1/2 transcription factors contributes to photoperiodic flowering by modulating an underlying diurnal rhythm in CONSTANS transcript levels.
    [PMID: 19619493]
  15. CONSTANS was found to bind DNA via a unique sequence element containing a consensus TGTG(N2-3)ATG motif present in tandem within the FLOWERING LOCUS T promoter.
    [PMID: 20406410]
  16. CONSTANS is repressed by the E3 ligase DAY NEUTRAL FLOWERING, which prevents early flowering in short days.
    [PMID: 20435904]
  17. CONSTANS (CO) forms a functional complex with ASYMMETRIC LEAVES 1 (AS1) to regulate FLOWERING LOCUS T (FT) expression and that AS1 plays different roles in two regulatory pathways, both of which concomitantly regulate the precise timing of flowering.
    [PMID: 21950734]
  18. PFT1 is an activator of CO transcription, and also of FT transcription, in a CO-independent manner. PFT1 acts as a hub, integrating a variety of interdependent environmental stimuli, including light quality and jasmonic acid-dependent defences.
    [PMID: 21985558]
  19. Overexpression of all FBH genes drastically elevated CO levels and caused early flowering regardless of photoperiod, whereas CO levels were reduced in the fbh quadruple mutants.
    [PMID: 22334645]
  20. HOS1 is required to modulate precisely the timing of CO accumulation and that this regulation is essential to maintain low levels of FT during the first part of the day and, subsequently, a correct photoperiodic response in Arabidopsis.
    [PMID: 22408073]
  21. study demonstrates that FKF1 protein stabilizes CONSTANS (CO)protein in the afternoon in long days; together with CO transcriptional regulation, FKF1 protein controls robust FLOWERING LOCUS T (FT) mRNA induction through multiple feedforward mechanisms that accurately control flowering timing
    [PMID: 22628657]
  22. the HOS1-CO module contributes to the fine-tuning of photoperiodic flowering under short term temperature fluctuations, which often occur during local weather disturbances.
    [PMID: 23135282]
  23. The lack of flowering promotion activity by COL1 and COL2 is mainly attributed to the differences between CO and the COL1 and COL2 proteins in the amino acid sequence encoded by their first exons.
    [PMID: 23265320]
  24. Photoperiodic flowering regulators CO and GI are involved in FT- and TSF-mediated stomatal opening induced by blue light.
    [PMID: 23669744]
  25. Natural variation in the cis-regulatory sequence in CONSTANS underlies flowering time diversity in Arabidopsis.
    [PMID: 24736505]
  26. Regulation of arabidopsis flowering by the histone mark readers MRG1/2 via interaction with CONSTANS to modulate FT expression
    [PMID: 25211338]
  27. BBX19 as a circadian clock output that depletes the active CO pool to accurately monitor daylength and precisely time FT expression.
    [PMID: 25228341]
  28. report that TARGET OF EAT1 (TOE1) and related proteins interact with the activation domain of CONSTANS (CO) and CO-like (COL) proteins and inhibit CO activity.
    [PMID: 25934507]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G15840.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a broad peak between 12 hours and dawn. Higher expression under long days.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G01060 (R), AT1G51700 (R), AT2G02450 (R), AT2G46830 (R), AT3G07650 (R), AT5G37260 (R), AT5G62430 (R)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G65480(A), AT1G69120(A), AT2G22630(A), AT2G45660(A), AT3G22231(A), AT4G20370(A), AT5G61850(A)
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G47640, AT1G08970, AT1G54830, AT1G56170
IntActSearch Q39057
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G15840
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0865740.0AY086574.1 Arabidopsis thaliana clone 2588 mRNA, complete sequence.
GenBankX949370.0X94937.1 A.thaliana mRNA for CONSTANS protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197088.10.0zinc finger protein CONSTANS
SwissprotQ390570.0CONS_ARATH; Zinc finger protein CONSTANS
TrEMBLB7U8J50.0B7U8J5_CHRMO; Constans-like protein
STRINGAT5G15840.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Representative plantOGRP6911767
Publications ? help Back to Top
  1. Aukerman MJ,Lee I,Weigel D,Amasino RM
    The Arabidopsis flowering-time gene LUMINIDEPENDENS is expressed primarily in regions of cell proliferation and encodes a nuclear protein that regulates LEAFY expression.
    Plant J., 1999. 18(2): p. 195-203
    [PMID:10363371]
  2. Melzer S,Kampmann G,Chandler J,Apel K
    FPF1 modulates the competence to flowering in Arabidopsis.
    Plant J., 1999. 18(4): p. 395-405
    [PMID:10406123]
  3. Fowler S, et al.
    GIGANTEA: a circadian clock-controlled gene that regulates photoperiodic flowering in Arabidopsis and encodes a protein with several possible membrane-spanning domains.
    EMBO J., 1999. 18(17): p. 4679-88
    [PMID:10469647]
  4. Yang CH,Chou ML
    FLD interacts with CO to affect both flowering time and floral initiation in Arabidopsis thaliana.
    Plant Cell Physiol., 1999. 40(6): p. 647-50
    [PMID:10483125]
  5. Soppe WJ,Bentsink L,Koornneef M
    The early-flowering mutant efs is involved in the autonomous promotion pathway of Arabidopsis thaliana.
    Development, 1999. 126(21): p. 4763-70
    [PMID:10518493]
  6. Kobayashi Y,Kaya H,Goto K,Iwabuchi M,Araki T
    A pair of related genes with antagonistic roles in mediating flowering signals.
    Science, 1999. 286(5446): p. 1960-2
    [PMID:10583960]
  7. Coupland G, et al.
    The regulation of flowering time by daylength in Arabidopsis.
    Symp. Soc. Exp. Biol., 1998. 51: p. 105-10
    [PMID:10645431]
  8. Kurup S,Jones HD,Holdsworth MJ
    Interactions of the developmental regulator ABI3 with proteins identified from developing Arabidopsis seeds.
    Plant J., 2000. 21(2): p. 143-55
    [PMID:10743655]
  9. Samach A, et al.
    Distinct roles of CONSTANS target genes in reproductive development of Arabidopsis.
    Science, 2000. 288(5471): p. 1613-6
    [PMID:10834834]
  10. Onouchi H,Ige
    Mutagenesis of plants overexpressing CONSTANS demonstrates novel interactions among Arabidopsis flowering-time genes.
    Plant Cell, 2000. 12(6): p. 885-900
    [PMID:10852935]
  11. Lee H, et al.
    The AGAMOUS-LIKE 20 MADS domain protein integrates floral inductive pathways in Arabidopsis.
    Genes Dev., 2000. 14(18): p. 2366-76
    [PMID:10995392]
  12. Lagercrantz U,Axelsson T
    Rapid evolution of the family of CONSTANS LIKE genes in plants.
    Mol. Biol. Evol., 2000. 17(10): p. 1499-507
    [PMID:11018156]
  13. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  14. Michaels SD,Amasino RM
    Loss of FLOWERING LOCUS C activity eliminates the late-flowering phenotype of FRIGIDA and autonomous pathway mutations but not responsiveness to vernalization.
    Plant Cell, 2001. 13(4): p. 935-41
    [PMID:11283346]
  15. Liu J,Yu J,McIntosh L,Kende H,Zeevaart JA
    Isolation of a CONSTANS ortholog from Pharbitis nil and its role in flowering.
    Plant Physiol., 2001. 125(4): p. 1821-30
    [PMID:11299362]
  16. Suárez-López P, et al.
    CONSTANS mediates between the circadian clock and the control of flowering in Arabidopsis.
    Nature, 2001. 410(6832): p. 1116-20
    [PMID:11323677]
  17. Ledger S,Strayer C,Ashton F,Kay SA,Putterill J
    Analysis of the function of two circadian-regulated CONSTANS-LIKE genes.
    Plant J., 2001. 26(1): p. 15-22
    [PMID:11359606]
  18. Chou ML,Haung MD,Yang CH
    EMF genes interact with late-flowering genes in regulating floral initiation genes during shoot development in Arabidopsis thaliana.
    Plant Cell Physiol., 2001. 42(5): p. 499-507
    [PMID:11382816]
  19. Reeves PH,Coupland G
    Analysis of flowering time control in Arabidopsis by comparison of double and triple mutants.
    Plant Physiol., 2001. 126(3): p. 1085-91
    [PMID:11457959]
  20. Samach A,Gover A
    Photoperiodism: the consistent use of CONSTANS.
    Curr. Biol., 2001. 11(16): p. R651-4
    [PMID:11525758]
  21. Ohto M, et al.
    Effects of sugar on vegetative development and floral transition in Arabidopsis.
    Plant Physiol., 2001. 127(1): p. 252-61
    [PMID:11553753]
  22. Axeisson T,Shavorskaya O,Lagercrantz U
    Multiple flowering time QTLs within several Brassica species could be the result of duplicated copies of one ancestral gene.
    Genome, 2001. 44(5): p. 856-64
    [PMID:11681610]
  23. Robson F, et al.
    Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants.
    Plant J., 2001. 28(6): p. 619-31
    [PMID:11851908]
  24. Mizoguchi T, et al.
    LHY and CCA1 are partially redundant genes required to maintain circadian rhythms in Arabidopsis.
    Dev. Cell, 2002. 2(5): p. 629-41
    [PMID:12015970]
  25. Osterberg MK,Shavorskaya O,Lascoux M,Lagercrantz U
    Naturally occurring indel variation in the Brassica nigra COL1 gene is associated with variation in flowering time.
    Genetics, 2002. 161(1): p. 299-306
    [PMID:12019243]
  26. Izawa T, et al.
    Phytochrome mediates the external light signal to repress FT orthologs in photoperiodic flowering of rice.
    Genes Dev., 2002. 16(15): p. 2006-20
    [PMID:12154129]
  27. Hepworth SR,Valverde F,Ravenscroft D,Mouradov A,Coupland G
    Antagonistic regulation of flowering-time gene SOC1 by CONSTANS and FLC via separate promoter motifs.
    EMBO J., 2002. 21(16): p. 4327-37
    [PMID:12169635]
  28. Halliday KJ,Koornneef M,Whitelam GC
    Phytochrome B and at Least One Other Phytochrome Mediate the Accelerated Flowering Response of Arabidopsis thaliana L. to Low Red/Far-Red Ratio.
    Plant Physiol., 1994. 104(4): p. 1311-1315
    [PMID:12232170]
  29. Yanovsky MJ,Kay SA
    Molecular basis of seasonal time measurement in Arabidopsis.
    Nature, 2002. 419(6904): p. 308-12
    [PMID:12239570]
  30. Roden LC,Song HR,Jackson S,Morris K,Carre IA
    Floral responses to photoperiod are correlated with the timing of rhythmic expression relative to dawn and dusk in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2002. 99(20): p. 13313-8
    [PMID:12271123]
  31. Mart
    Control of photoperiod-regulated tuberization in potato by the Arabidopsis flowering-time gene CONSTANS.
    Proc. Natl. Acad. Sci. U.S.A., 2002. 99(23): p. 15211-6
    [PMID:12393812]
  32. Davis SJ
    Photoperiodism: the coincidental perception of the season.
    Curr. Biol., 2002. 12(24): p. R841-3
    [PMID:12498702]
  33. Moon YH, et al.
    EMF genes maintain vegetative development by repressing the flower program in Arabidopsis.
    Plant Cell, 2003. 15(3): p. 681-93
    [PMID:12615941]
  34. Griffiths S,Dunford RP,Coupland G,Laurie DA
    The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis.
    Plant Physiol., 2003. 131(4): p. 1855-67
    [PMID:12692345]
  35. Hayama R,Yokoi S,Tamaki S,Yano M,Shimamoto K
    Adaptation of photoperiodic control pathways produces short-day flowering in rice.
    Nature, 2003. 422(6933): p. 719-22
    [PMID:12700762]
  36. Kim SJ,Moon J,Lee I,Maeng J,Kim SR
    Molecular cloning and expression analysis of a CONSTANS homologue, PnCOL1, from Pharbitis nil.
    J. Exp. Bot., 2003. 54(389): p. 1879-87
    [PMID:12837818]
  37. Simpson GG
    Evolution of flowering in response to day length: flipping the CONSTANS switch.
    Bioessays, 2003. 25(9): p. 829-32
    [PMID:12938171]
  38. Moon J, et al.
    The SOC1 MADS-box gene integrates vernalization and gibberellin signals for flowering in Arabidopsis.
    Plant J., 2003. 35(5): p. 613-23
    [PMID:12940954]
  39. Nemoto Y,Kisaka M,Fuse T,Yano M,Ogihara Y
    Characterization and functional analysis of three wheat genes with homology to the CONSTANS flowering time gene in transgenic rice.
    Plant J., 2003. 36(1): p. 82-93
    [PMID:12974813]
  40. Cremer F,Coupland G
    Distinct photoperiodic responses are conferred by the same genetic pathway in Arabidopsis and in rice.
    Trends Plant Sci., 2003. 8(9): p. 405-7
    [PMID:13678904]
  41. Tzeng TY,Hsiao CC,Chi PJ,Yang CH
    Two lily SEPALLATA-like genes cause different effects on floral formation and floral transition in Arabidopsis.
    Plant Physiol., 2003. 133(3): p. 1091-101
    [PMID:14526112]
  42. Schmid M, et al.
    Dissection of floral induction pathways using global expression analysis.
    Development, 2003. 130(24): p. 6001-12
    [PMID:14573523]
  43. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  44. El-Din El-Assal S, et al.
    The role of cryptochrome 2 in flowering in Arabidopsis.
    Plant Physiol., 2003. 133(4): p. 1504-16
    [PMID:14605222]
  45. Imaizumi T,Tran HG,Swartz TE,Briggs WR,Kay SA
    FKF1 is essential for photoperiodic-specific light signalling in Arabidopsis.
    Nature, 2003. 426(6964): p. 302-6
    [PMID:14628054]
  46. Takada S,Goto K
    Terminal flower2, an Arabidopsis homolog of heterochromatin protein1, counteracts the activation of flowering locus T by constans in the vascular tissues of leaves to regulate flowering time.
    Plant Cell, 2003. 15(12): p. 2856-65
    [PMID:14630968]
  47. Mart
    Salicylic acid regulates flowering time and links defence responses and reproductive development.
    Plant J., 2004. 37(2): p. 209-17
    [PMID:14690505]
  48. Oda A,Fujiwara S,Kamada H,Coupland G,Mizoguchi T
    Antisense suppression of the Arabidopsis PIF3 gene does not affect circadian rhythms but causes early flowering and increases FT expression.
    FEBS Lett., 2004. 557(1-3): p. 259-64
    [PMID:14741378]
  49. Valverde F, et al.
    Photoreceptor regulation of CONSTANS protein in photoperiodic flowering.
    Science, 2004. 303(5660): p. 1003-6
    [PMID:14963328]
  50. Somers DE,Kim WY,Geng R
    The F-box protein ZEITLUPE confers dosage-dependent control on the circadian clock, photomorphogenesis, and flowering time.
    Plant Cell, 2004. 16(3): p. 769-82
    [PMID:14973171]
  51. Searle I,Coupland G
    Induction of flowering by seasonal changes in photoperiod.
    EMBO J., 2004. 23(6): p. 1217-22
    [PMID:15014450]
  52. Tseng TS,Salomé PA,McClung CR,Olszewski NE
    SPINDLY and GIGANTEA interact and act in Arabidopsis thaliana pathways involved in light responses, flowering, and rhythms in cotyledon movements.
    Plant Cell, 2004. 16(6): p. 1550-63
    [PMID:15155885]
  53. An H, et al.
    CONSTANS acts in the phloem to regulate a systemic signal that induces photoperiodic flowering of Arabidopsis.
    Development, 2004. 131(15): p. 3615-26
    [PMID:15229176]
  54. Ayre BG,Turgeon R
    Graft transmission of a floral stimulant derived from CONSTANS.
    Plant Physiol., 2004. 135(4): p. 2271-8
    [PMID:15299137]
  55. Farrona S,Hurtado L,Bowman JL,Reyes JC
    The Arabidopsis thaliana SNF2 homolog AtBRM controls shoot development and flowering.
    Development, 2004. 131(20): p. 4965-75
    [PMID:15371304]
  56. He Y, et al.
    Nitric oxide represses the Arabidopsis floral transition.
    Science, 2004. 305(5692): p. 1968-71
    [PMID:15448272]
  57. Jeong S,Clark SE
    Photoperiod regulates flower meristem development in Arabidopsis thaliana.
    Genetics, 2005. 169(2): p. 907-15
    [PMID:15489527]
  58. Shimizu M,Ichikawa K,Aoki S
    Photoperiod-regulated expression of the PpCOL1 gene encoding a homolog of CO/COL proteins in the moss Physcomitrella patens.
    Biochem. Biophys. Res. Commun., 2004. 324(4): p. 1296-301
    [PMID:15504355]
  59. Michaels SD,Himelblau E,Kim SY,Schomburg FM,Amasino RM
    Integration of flowering signals in winter-annual Arabidopsis.
    Plant Physiol., 2005. 137(1): p. 149-56
    [PMID:15618421]
  60. Moon J,Lee H,Kim M,Lee I
    Analysis of flowering pathway integrators in Arabidopsis.
    Plant Cell Physiol., 2005. 46(2): p. 292-9
    [PMID:15695467]
  61. Hecht V, et al.
    Conservation of Arabidopsis flowering genes in model legumes.
    Plant Physiol., 2005. 137(4): p. 1420-34
    [PMID:15778459]
  62. Zobell O,Coupland G,Reiss B
    The family of CONSTANS-like genes in Physcomitrella patens.
    Plant Biol (Stuttg), 2005. 7(3): p. 266-75
    [PMID:15912446]
  63. Fukamatsu Y, et al.
    Identification of LOV KELCH PROTEIN2 (LKP2)-interacting factors that can recruit LKP2 to nuclear bodies.
    Plant Cell Physiol., 2005. 46(8): p. 1340-9
    [PMID:15937324]
  64. Yamaguchi A,Kobayashi Y,Goto K,Abe M,Araki T
    TWIN SISTER OF FT (TSF) acts as a floral pathway integrator redundantly with FT.
    Plant Cell Physiol., 2005. 46(8): p. 1175-89
    [PMID:15951566]
  65. Imaizumi T,Schultz TF,Harmon FG,Ho LA,Kay SA
    FKF1 F-box protein mediates cyclic degradation of a repressor of CONSTANS in Arabidopsis.
    Science, 2005. 309(5732): p. 293-7
    [PMID:16002617]
  66. Mizoguchi T, et al.
    Distinct roles of GIGANTEA in promoting flowering and regulating circadian rhythms in Arabidopsis.
    Plant Cell, 2005. 17(8): p. 2255-70
    [PMID:16006578]
  67. Abe M, et al.
    FD, a bZIP protein mediating signals from the floral pathway integrator FT at the shoot apex.
    Science, 2005. 309(5737): p. 1052-6
    [PMID:16099979]
  68. Cheng XF,Wang ZY
    Overexpression of COL9, a CONSTANS-LIKE gene, delays flowering by reducing expression of CO and FT in Arabidopsis thaliana.
    Plant J., 2005. 43(5): p. 758-68
    [PMID:16115071]
  69. Yoo SK, et al.
    CONSTANS activates SUPPRESSOR OF OVEREXPRESSION OF CONSTANS 1 through FLOWERING LOCUS T to promote flowering in Arabidopsis.
    Plant Physiol., 2005. 139(2): p. 770-8
    [PMID:16183837]
  70. Kim WY,Hicks KA,Somers DE
    Independent roles for EARLY FLOWERING 3 and ZEITLUPE in the control of circadian timing, hypocotyl length, and flowering time.
    Plant Physiol., 2005. 139(3): p. 1557-69
    [PMID:16258016]
  71. Datta S,Hettiarachchi GH,Deng XW,Holm M
    Arabidopsis CONSTANS-LIKE3 is a positive regulator of red light signaling and root growth.
    Plant Cell, 2006. 18(1): p. 70-84
    [PMID:16339850]
  72. Ben-Naim O, et al.
    The CCAAT binding factor can mediate interactions between CONSTANS-like proteins and DNA.
    Plant J., 2006. 46(3): p. 462-76
    [PMID:16623906]
  73. Ishikawa M,Kiba T,Chua NH
    The Arabidopsis SPA1 gene is required for circadian clock function and photoperiodic flowering.
    Plant J., 2006. 46(5): p. 736-46
    [PMID:16709190]
  74. Chen M,Ni M
    RFI2, a RING-domain zinc finger protein, negatively regulates CONSTANS expression and photoperiodic flowering.
    Plant J., 2006. 46(5): p. 823-33
    [PMID:16709197]
  75. Balasubramanian S,Sureshkumar S,Lempe J,Weigel D
    Potent induction of Arabidopsis thaliana flowering by elevated growth temperature.
    PLoS Genet., 2006. 2(7): p. e106
    [PMID:16839183]
  76. Laubinger S, et al.
    Arabidopsis SPA proteins regulate photoperiodic flowering and interact with the floral inducer CONSTANS to regulate its stability.
    Development, 2006. 133(16): p. 3213-22
    [PMID:16854975]
  77. Thomas B
    Light signals and flowering.
    J. Exp. Bot., 2006. 57(13): p. 3387-93
    [PMID:16980594]
  78. Jaeger KE,Graf A,Wigge PA
    The control of flowering in time and space.
    J. Exp. Bot., 2006. 57(13): p. 3415-8
    [PMID:17005922]
  79. Imaizumi T,Kay SA
    Photoperiodic control of flowering: not only by coincidence.
    Trends Plant Sci., 2006. 11(11): p. 550-8
    [PMID:17035069]
  80. Martin-Tryon EL,Kreps JA,Harmer SL
    GIGANTEA acts in blue light signaling and has biochemically separable roles in circadian clock and flowering time regulation.
    Plant Physiol., 2007. 143(1): p. 473-86
    [PMID:17098855]
  81. Wang H, et al.
    Earlier flowering induced by over-expression of CO gene does not accompany increase of artemisinin biosynthesis in Artemisia annua.
    Plant Biol (Stuttg), 2007. 9(3): p. 442-6
    [PMID:17099845]
  82. Wenkel S, et al.
    CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis.
    Plant Cell, 2006. 18(11): p. 2971-84
    [PMID:17138697]
  83. Takase T,Yasuhara M,Geekiyanage S,Ogura Y,Kiyosue T
    Overexpression of the chimeric gene of the floral regulator CONSTANS and the EAR motif repressor causes late flowering in Arabidopsis.
    Plant Cell Rep., 2007. 26(6): p. 815-21
    [PMID:17219103]
  84. Sjödin P, et al.
    Recent degeneration of an old duplicated flowering time gene in Brassica nigra.
    Heredity, 2007. 98(6): p. 375-84
    [PMID:17344804]
  85. Locatelli AB, et al.
    Loci affecting flowering time in oat under short-day conditions.
    Genome, 2006. 49(12): p. 1528-38
    [PMID:17426767]
  86. Kuhn JM,Breton G,Schroeder JI
    mRNA metabolism of flowering-time regulators in wild-type Arabidopsis revealed by a nuclear cap binding protein mutant, abh1.
    Plant J., 2007. 50(6): p. 1049-62
    [PMID:17488241]
  87. Nakamichi N, et al.
    Arabidopsis clock-associated pseudo-response regulators PRR9, PRR7 and PRR5 coordinately and positively regulate flowering time through the canonical CONSTANS-dependent photoperiodic pathway.
    Plant Cell Physiol., 2007. 48(6): p. 822-32
    [PMID:17504813]
  88. Mathieu J,Warthmann N,K
    Export of FT protein from phloem companion cells is sufficient for floral induction in Arabidopsis.
    Curr. Biol., 2007. 17(12): p. 1055-60
    [PMID:17540570]
  89. Zhang X, et al.
    Constitutive expression of CIR1 (RVE2) affects several circadian-regulated processes and seed germination in Arabidopsis.
    Plant J., 2007. 51(3): p. 512-25
    [PMID:17587236]
  90. Yoo SY,Kim Y,Kim SY,Lee JS,Ahn JH
    Control of flowering time and cold response by a NAC-domain protein in Arabidopsis.
    PLoS ONE, 2007. 2(7): p. e642
    [PMID:17653269]
  91. Portol
    Altered oscillator function affects clock resonance and is responsible for the reduced day-length sensitivity of CKB4 overexpressing plants.
    Plant J., 2007. 51(6): p. 966-77
    [PMID:17662034]
  92. Izawa T
    Adaptation of flowering-time by natural and artificial selection in Arabidopsis and rice.
    J. Exp. Bot., 2007. 58(12): p. 3091-7
    [PMID:17693414]
  93. Sawa M,Nusinow DA,Kay SA,Imaizumi T
    FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis.
    Science, 2007. 318(5848): p. 261-5
    [PMID:17872410]
  94. Jung JH, et al.
    The GIGANTEA-regulated microRNA172 mediates photoperiodic flowering independent of CONSTANS in Arabidopsis.
    Plant Cell, 2007. 19(9): p. 2736-48
    [PMID:17890372]
  95. Kobayashi Y,Weigel D
    Move on up, it's time for change--mobile signals controlling photoperiod-dependent flowering.
    Genes Dev., 2007. 21(19): p. 2371-84
    [PMID:17908925]
  96. Kang X,Zhou Y,Sun X,Ni M
    HYPERSENSITIVE TO RED AND BLUE 1 and its C-terminal regulatory function control FLOWERING LOCUS T expression.
    Plant J., 2007. 52(5): p. 937-48
    [PMID:17916114]
  97. Razi H,Howell EC,Newbury HJ,Kearsey MJ
    Does sequence polymorphism of FLC paralogues underlie flowering time QTL in Brassica oleracea?
    Theor. Appl. Genet., 2008. 116(2): p. 179-92
    [PMID:17938878]
  98. Mayfield JD,Folta KM,Paul AL,Ferl RJ
    The 14-3-3 Proteins mu and upsilon influence transition to flowering and early phytochrome response.
    Plant Physiol., 2007. 145(4): p. 1692-702
    [PMID:17951453]
  99. Hayama R,Agashe B,Luley E,King R,Coupland G
    A circadian rhythm set by dusk determines the expression of FT homologs and the short-day photoperiodic flowering response in Pharbitis.
    Plant Cell, 2007. 19(10): p. 2988-3000
    [PMID:17965272]
  100. Tan FC,Swain SM
    Functional characterization of AP3, SOC1 and WUS homologues from citrus (Citrus sinensis).
    Physiol Plant, 2007. 131(3): p. 481-95
    [PMID:18251886]
  101. Liu LJ, et al.
    COP1-mediated ubiquitination of CONSTANS is implicated in cryptochrome regulation of flowering in Arabidopsis.
    Plant Cell, 2008. 20(2): p. 292-306
    [PMID:18296627]
  102. Abe M,Fujiwara M,Kurotani K,Yokoi S,Shimamoto K
    Identification of dynamin as an interactor of rice GIGANTEA by tandem affinity purification (TAP).
    Plant Cell Physiol., 2008. 49(3): p. 420-32
    [PMID:18296724]
  103. Xing D,Zhao H,Xu R,Li QQ
    Arabidopsis PCFS4, a homologue of yeast polyadenylation factor Pcf11p, regulates FCA alternative processing and promotes flowering time.
    Plant J., 2008. 54(5): p. 899-910
    [PMID:18298670]
  104. Miller TA,Muslin EH,Dorweiler JE
    A maize CONSTANS-like gene, conz1, exhibits distinct diurnal expression patterns in varied photoperiods.
    Planta, 2008. 227(6): p. 1377-88
    [PMID:18301915]
  105. Han P,García-Ponce B,Fonseca-Salazar G,Alvarez-Buylla ER,Yu H
    AGAMOUS-LIKE 17, a novel flowering promoter, acts in a FT-independent photoperiod pathway.
    Plant J., 2008. 55(2): p. 253-65
    [PMID:18363787]
  106. Jang S, et al.
    Arabidopsis COP1 shapes the temporal pattern of CO accumulation conferring a photoperiodic flowering response.
    EMBO J., 2008. 27(8): p. 1277-88
    [PMID:18388858]
  107. Sawa M,Kay SA
    [Molecular mechanism by which plant determines flowering timing with circadian clock]
    Tanpakushitsu Kakusan Koso, 2008. 53(6): p. 739-46
    [PMID:18453150]
  108. Salom
    Circadian timekeeping during early Arabidopsis development.
    Plant Physiol., 2008. 147(3): p. 1110-25
    [PMID:18480377]
  109. Chia TY,M
    Sugar beet contains a large CONSTANS-LIKE gene family including a CO homologue that is independent of the early-bolting (B) gene locus.
    J. Exp. Bot., 2008. 59(10): p. 2735-48
    [PMID:18495636]
  110. Streitner C, et al.
    The small glycine-rich RNA binding protein AtGRP7 promotes floral transition in Arabidopsis thaliana.
    Plant J., 2008. 56(2): p. 239-50
    [PMID:18573194]
  111. Song YH, et al.
    Isolation of CONSTANS as a TGA4/OBF4 interacting protein.
    Mol. Cells, 2008. 25(4): p. 559-65
    [PMID:18587275]
  112. Kumimoto RW, et al.
    The Nuclear Factor Y subunits NF-YB2 and NF-YB3 play additive roles in the promotion of flowering by inductive long-day photoperiods in Arabidopsis.
    Planta, 2008. 228(5): p. 709-23
    [PMID:18600346]
  113. Kuhn JM,Hugouvieux V,Schroeder JI
    mRNA cap binding proteins: effects on abscisic acid signal transduction, mRNA processing, and microarray analyses.
    Curr. Top. Microbiol. Immunol., 2008. 326: p. 139-50
    [PMID:18630751]
  114. Kim SY,Yu X,Michaels SD
    Regulation of CONSTANS and FLOWERING LOCUS T expression in response to changing light quality.
    Plant Physiol., 2008. 148(1): p. 269-79
    [PMID:18667727]
  115. Wu JF,Wang Y,Wu SH
    Two new clock proteins, LWD1 and LWD2, regulate Arabidopsis photoperiodic flowering.
    Plant Physiol., 2008. 148(2): p. 948-59
    [PMID:18676661]
  116. Castillejo C,Pelaz S
    The balance between CONSTANS and TEMPRANILLO activities determines FT expression to trigger flowering.
    Curr. Biol., 2008. 18(17): p. 1338-43
    [PMID:18718758]
  117. Matsubara K, et al.
    Ehd2, a rice ortholog of the maize INDETERMINATE1 gene, promotes flowering by up-regulating Ehd1.
    Plant Physiol., 2008. 148(3): p. 1425-35
    [PMID:18790997]
  118. Wollenberg AC,Strasser B,Cerdán PD,Amasino RM
    Acceleration of flowering during shade avoidance in Arabidopsis alters the balance between FLOWERING LOCUS C-mediated repression and photoperiodic induction of flowering.
    Plant Physiol., 2008. 148(3): p. 1681-94
    [PMID:18790998]
  119. Buchovsky AS,Strasser B,Cerd
    Suppression of pleiotropic effects of functional cryptochrome genes by Terminal Flower 1.
    Genetics, 2008. 180(3): p. 1467-74
    [PMID:18791256]
  120. Burgos-Rivera B, et al.
    ACTIN DEPOLYMERIZING FACTOR9 controls development and gene expression in Arabidopsis.
    Plant Mol. Biol., 2008. 68(6): p. 619-32
    [PMID:18830798]
  121. King RW,Hisamatsu T,Goldschmidt EE,Blundell C
    The nature of floral signals in Arabidopsis. I. Photosynthesis and a far-red photoresponse independently regulate flowering by increasing expression of FLOWERING LOCUS T (FT).
    J. Exp. Bot., 2008. 59(14): p. 3811-20
    [PMID:18836142]
  122. Demarsy E,Fankhauser C
    Higher plants use LOV to perceive blue light.
    Curr. Opin. Plant Biol., 2009. 12(1): p. 69-74
    [PMID:18930433]
  123. Michaels SD
    Flowering time regulation produces much fruit.
    Curr. Opin. Plant Biol., 2009. 12(1): p. 75-80
    [PMID:18938104]
  124. Koornneef M,Hanhart CJ,van der Veen JH
    A genetic and physiological analysis of late flowering mutants in Arabidopsis thaliana.
    Mol. Gen. Genet., 1991. 229(1): p. 57-66
    [PMID:1896021]
  125. Melzer S, et al.
    Flowering-time genes modulate meristem determinacy and growth form in Arabidopsis thaliana.
    Nat. Genet., 2008. 40(12): p. 1489-92
    [PMID:18997783]
  126. Fujiwara S, et al.
    Circadian clock proteins LHY and CCA1 regulate SVP protein accumulation to control flowering in Arabidopsis.
    Plant Cell, 2008. 20(11): p. 2960-71
    [PMID:19011118]
  127. Ni Z, et al.
    Altered circadian rhythms regulate growth vigour in hybrids and allopolyploids.
    Nature, 2009. 457(7227): p. 327-31
    [PMID:19029881]
  128. Yu JW, et al.
    COP1 and ELF3 control circadian function and photoperiodic flowering by regulating GI stability.
    Mol. Cell, 2008. 32(5): p. 617-30
    [PMID:19061637]
  129. Holefors A, et al.
    Identification of PaCOL1 and PaCOL2, two CONSTANS-like genes showing decreased transcript levels preceding short day induced growth cessation in Norway spruce.
    Plant Physiol. Biochem., 2009. 47(2): p. 105-15
    [PMID:19097801]
  130. Jackson SD
    Plant responses to photoperiod.
    New Phytol., 2009. 181(3): p. 517-31
    [PMID:19154317]
  131. Serrano G, et al.
    Chlamydomonas CONSTANS and the evolution of plant photoperiodic signaling.
    Curr. Biol., 2009. 19(5): p. 359-68
    [PMID:19230666]
  132. Nilsson O
    Plant evolution: measuring the length of the day.
    Curr. Biol., 2009. 19(7): p. R302-3
    [PMID:19368878]
  133. Stangeland B, et al.
    AtMBD8 is involved in control of flowering time in the C24 ecotype of Arabidopsis thaliana.
    Physiol Plant, 2009. 136(1): p. 110-26
    [PMID:19374717]
  134. Yoshida R, et al.
    Possible role of early flowering 3 (ELF3) in clock-dependent floral regulation by short vegetative phase (SVP) in Arabidopsis thaliana.
    New Phytol., 2009. 182(4): p. 838-50
    [PMID:19383102]
  135. Zhou Y,Ni M
    SHB1 plays dual roles in photoperiodic and autonomous flowering.
    Dev. Biol., 2009. 331(1): p. 50-7
    [PMID:19406114]
  136. Winfield MO,Lu C,Wilson ID,Coghill JA,Edwards KJ
    Cold- and light-induced changes in the transcriptome of wheat leading to phase transition from vegetative to reproductive growth.
    BMC Plant Biol., 2009. 9: p. 55
    [PMID:19432994]
  137. D'Aloia M, et al.
    Gene activation cascade triggered by a single photoperiodic cycle inducing flowering in Sinapis alba.
    Plant J., 2009. 59(6): p. 962-73
    [PMID:19473326]
  138. Hassidim M,Harir Y,Yakir E,Kron I,Green RM
    Over-expression of CONSTANS-LIKE 5 can induce flowering in short-day grown Arabidopsis.
    Planta, 2009. 230(3): p. 481-91
    [PMID:19504268]
  139. Mathieu J,Yant LJ,Mürdter F,Küttner F,Schmid M
    Repression of flowering by the miR172 target SMZ.
    PLoS Biol., 2009. 7(7): p. e1000148
    [PMID:19582143]
  140. Fornara F, et al.
    Arabidopsis DOF transcription factors act redundantly to reduce CONSTANS expression and are essential for a photoperiodic flowering response.
    Dev. Cell, 2009. 17(1): p. 75-86
    [PMID:19619493]
  141. Sawa M,Kay SA,Imaizumi T
    Photoperiodic flowering occurs under internal and external coincidence.
    Plant Signal Behav, 2008. 3(4): p. 269-71
    [PMID:19704651]
  142. Segarra S,Mir R,Mart
    Genome-wide analyses of the transcriptomes of salicylic acid-deficient versus wild-type plants uncover Pathogen and Circadian Controlled 1 (PCC1) as a regulator of flowering time in Arabidopsis.
    Plant Cell Environ., 2010. 33(1): p. 11-22
    [PMID:19781011]
  143. Romero JM,Valverde F
    Evolutionarily conserved photoperiod mechanisms in plants: when did plant photoperiodic signaling appear?
    Plant Signal Behav, 2009. 4(7): p. 642-4
    [PMID:19820341]
  144. Imaizumi T
    Arabidopsis circadian clock and photoperiodism: time to think about location.
    Curr. Opin. Plant Biol., 2010. 13(1): p. 83-9
    [PMID:19836294]
  145. Folta KM,Paul AL,Mayfield JD,Ferl RJ
    14-3-3 isoforms participate in red light signaling and photoperiodic flowering.
    Plant Signal Behav, 2008. 3(5): p. 304-6
    [PMID:19841653]
  146. Khanna R, et al.
    The Arabidopsis B-box zinc finger family.
    Plant Cell, 2009. 21(11): p. 3416-20
    [PMID:19920209]
  147. Salazar JD, et al.
    Prediction of photoperiodic regulators from quantitative gene circuit models.
    Cell, 2009. 139(6): p. 1170-9
    [PMID:20005809]
  148. Ogiso E,Takahashi Y,Sasaki T,Yano M,Izawa T
    The role of casein kinase II in flowering time regulation has diversified during evolution.
    Plant Physiol., 2010. 152(2): p. 808-20
    [PMID:20007447]
  149. Chen H, et al.
    Arabidopsis CULLIN4-damaged DNA binding protein 1 interacts with CONSTITUTIVELY PHOTOMORPHOGENIC1-SUPPRESSOR OF PHYA complexes to regulate photomorphogenesis and flowering time.
    Plant Cell, 2010. 22(1): p. 108-23
    [PMID:20061554]
  150. Inui H,Ogura Y,Kiyosue T
    Overexpression of Arabidopsis thaliana LOV KELCH REPEAT PROTEIN 2 promotes tuberization in potato (Solanum tuberosum cv. May Queen).
    FEBS Lett., 2010. 584(11): p. 2393-6
    [PMID:20399775]
  151. Tiwari SB, et al.
    The flowering time regulator CONSTANS is recruited to the FLOWERING LOCUS T promoter via a unique cis-element.
    New Phytol., 2010. 187(1): p. 57-66
    [PMID:20406410]
  152. Lee YS, et al.
    OsCOL4 is a constitutive flowering repressor upstream of Ehd1 and downstream of OsphyB.
    Plant J., 2010. 63(1): p. 18-30
    [PMID:20409004]
  153. Morris K, et al.
    DAY NEUTRAL FLOWERING represses CONSTANS to prevent Arabidopsis flowering early in short days.
    Plant Cell, 2010. 22(4): p. 1118-28
    [PMID:20435904]
  154. Adrian J, et al.
    cis-Regulatory elements and chromatin state coordinately control temporal and spatial expression of FLOWERING LOCUS T in Arabidopsis.
    Plant Cell, 2010. 22(5): p. 1425-40
    [PMID:20472817]
  155. Kumimoto RW,Zhang Y,Siefers N,Holt BF
    NF-YC3, NF-YC4 and NF-YC9 are required for CONSTANS-mediated, photoperiod-dependent flowering in Arabidopsis thaliana.
    Plant J., 2010. 63(3): p. 379-91
    [PMID:20487380]
  156. Fujino K, et al.
    Multiple introgression events surrounding the Hd1 flowering-time gene in cultivated rice, Oryza sativa L.
    Mol. Genet. Genomics, 2010. 284(2): p. 137-46
    [PMID:20607290]
  157. Morris K,Jackson SP
    DAY NEUTRAL FLOWERING does not act through GIGANTEA and FKF1 to regulate CONSTANS expression and flowering time.
    Plant Signal Behav, 2010. 5(9): p. 1105-7
    [PMID:20818180]
  158. Abelenda JA,Navarro C,Prat S
    From the model to the crop: genes controlling tuber formation in potato.
    Curr. Opin. Biotechnol., 2011. 22(2): p. 287-92
    [PMID:21168321]
  159. Yoo SK,Wu X,Lee JS,Ahn JH
    AGAMOUS-LIKE 6 is a floral promoter that negatively regulates the FLC/MAF clade genes and positively regulates FT in Arabidopsis.
    Plant J., 2011. 65(1): p. 62-76
    [PMID:21175890]
  160. Ranjan A,Fiene G,Fackendahl P,Hoecker U
    The Arabidopsis repressor of light signaling SPA1 acts in the phloem to regulate seedling de-etiolation, leaf expansion and flowering time.
    Development, 2011. 138(9): p. 1851-62
    [PMID:21447551]
  161. P
    Expression analysis of phytochromes A, B and floral integrator genes during the entry and exit of grapevine-buds from endodormancy.
    J. Plant Physiol., 2011. 168(14): p. 1659-66
    [PMID:21453983]
  162. Shen L,Yu H
    J3 regulation of flowering time is mainly contributed by its activity in leaves.
    Plant Signal Behav, 2011. 6(4): p. 601-3
    [PMID:21494090]
  163. Ishikawa R, et al.
    Phytochrome B regulates Heading date 1 (Hd1)-mediated expression of rice florigen Hd3a and critical day length in rice.
    Mol. Genet. Genomics, 2011. 285(6): p. 461-70
    [PMID:21512732]
  164. Zuo Z,Liu H,Liu B,Liu X,Lin C
    Blue light-dependent interaction of CRY2 with SPA1 regulates COP1 activity and floral initiation in Arabidopsis.
    Curr. Biol., 2011. 21(10): p. 841-7
    [PMID:21514160]
  165. Kunihiro A, et al.
    Phytochrome-interacting factor 4 and 5 (PIF4 and PIF5) activate the homeobox ATHB2 and auxin-inducible IAA29 genes in the coincidence mechanism underlying photoperiodic control of plant growth of Arabidopsis thaliana.
    Plant Cell Physiol., 2011. 52(8): p. 1315-29
    [PMID:21666227]
  166. Sawa M,Kay SA
    GIGANTEA directly activates Flowering Locus T in Arabidopsis thaliana.
    Proc. Natl. Acad. Sci. U.S.A., 2011. 108(28): p. 11698-703
    [PMID:21709243]
  167. Weingartner M,Subert C,Sauer N
    LATE, a C(2)H(2) zinc-finger protein that acts as floral repressor.
    Plant J., 2011. 68(4): p. 681-92
    [PMID:21771123]
  168. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  169. Shan H, et al.
    Heterologous expression of the chrysanthemum R2R3-MYB transcription factor CmMYB2 enhances drought and salinity tolerance, increases hypersensitivity to ABA and delays flowering in Arabidopsis thaliana.
    Mol. Biotechnol., 2012. 51(2): p. 160-73
    [PMID:21901277]
  170. Kobayashi M,Takato H,Fujita K,Suzuki S
    HSG1, a grape Bcl-2-associated athanogene, promotes floral transition by activating CONSTANS expression in transgenic Arabidopsis plant.
    Mol. Biol. Rep., 2012. 39(4): p. 4367-74
    [PMID:21901420]
  171. Navarro C, et al.
    Control of flowering and storage organ formation in potato by FLOWERING LOCUS T.
    Nature, 2011. 478(7367): p. 119-22
    [PMID:21947007]
  172. Song YH,Lee I,Lee SY,Imaizumi T,Hong JC
    CONSTANS and ASYMMETRIC LEAVES 1 complex is involved in the induction of FLOWERING LOCUS T in photoperiodic flowering in Arabidopsis.
    Plant J., 2012. 69(2): p. 332-42
    [PMID:21950734]
  173. Takahashi Y,Shimamoto K
    Heading date 1 (Hd1), an ortholog of Arabidopsis CONSTANS, is a possible target of human selection during domestication to diversify flowering times of cultivated rice.
    Genes Genet. Syst., 2011. 86(3): p. 175-82
    [PMID:21952207]
  174. I
    PFT1, the MED25 subunit of the plant Mediator complex, promotes flowering through CONSTANS dependent and independent mechanisms in Arabidopsis.
    Plant J., 2012. 69(4): p. 601-12
    [PMID:21985558]
  175. Campoli C,Drosse B,Searle I,Coupland G,von Korff M
    Functional characterisation of HvCO1, the barley (Hordeum vulgare) flowering time ortholog of CONSTANS.
    Plant J., 2012. 69(5): p. 868-80
    [PMID:22040323]
  176. Lu SX, et al.
    CCA1 and ELF3 Interact in the control of hypocotyl length and flowering time in Arabidopsis.
    Plant Physiol., 2012. 158(2): p. 1079-88
    [PMID:22190341]
  177. Chen J, et al.
    Molecular characterization and expression profiles of MaCOL1, a CONSTANS-like gene in banana fruit.
    Gene, 2012. 496(2): p. 110-7
    [PMID:22285923]
  178. Tiwari SB, et al.
    The EDLL motif: a potent plant transcriptional activation domain from AP2/ERF transcription factors.
    Plant J., 2012. 70(5): p. 855-65
    [PMID:22321262]
  179. Lee JH,Park SH,Ahn JH
    Functional conservation and diversification between rice OsMADS22/OsMADS55 and Arabidopsis SVP proteins.
    Plant Sci., 2012. 185-186: p. 97-104
    [PMID:22325870]
  180. Ito S, et al.
    FLOWERING BHLH transcriptional activators control expression of the photoperiodic flowering regulator CONSTANS in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2012. 109(9): p. 3582-7
    [PMID:22334645]
  181. Lazaro A,Valverde F,Pi
    The Arabidopsis E3 ubiquitin ligase HOS1 negatively regulates CONSTANS abundance in the photoperiodic control of flowering.
    Plant Cell, 2012. 24(3): p. 982-99
    [PMID:22408073]
  182. Song YH,Smith RW,To BJ,Millar AJ,Imaizumi T
    FKF1 conveys timing information for CONSTANS stabilization in photoperiodic flowering.
    Science, 2012. 336(6084): p. 1045-9
    [PMID:22628657]
  183. Ballerini ES,Kramer EM
    In the Light of Evolution: A Reevaluation of Conservation in the CO-FT Regulon and Its Role in Photoperiodic Regulation of Flowering Time.
    Front Plant Sci, 2011. 2: p. 81
    [PMID:22639612]
  184. Kwon E, et al.
    AtGSNOR1 function is required for multiple developmental programs in Arabidopsis.
    Planta, 2012. 236(3): p. 887-900
    [PMID:22767201]
  185. Immink RG, et al.
    Characterization of SOC1's central role in flowering by the identification of its upstream and downstream regulators.
    Plant Physiol., 2012. 160(1): p. 433-49
    [PMID:22791302]
  186. Galv
    Spatial control of flowering by DELLA proteins in Arabidopsis thaliana.
    Development, 2012. 139(21): p. 4072-82
    [PMID:22992955]
  187. Meinke DW
    A survey of dominant mutations in Arabidopsis thaliana.
    Trends Plant Sci., 2013. 18(2): p. 84-91
    [PMID:22995285]
  188. Hsu CY, et al.
    Overexpression of CONSTANS homologs CO1 and CO2 fails to alter normal reproductive onset and fall bud set in woody perennial poplar.
    PLoS ONE, 2012. 7(9): p. e45448
    [PMID:23029015]
  189. Jung JH,Seo PJ,Park CM
    The E3 ubiquitin ligase HOS1 regulates Arabidopsis flowering by mediating CONSTANS degradation under cold stress.
    J. Biol. Chem., 2012. 287(52): p. 43277-87
    [PMID:23135282]
  190. Takato H,Shimidzu M,Ashizawa Y,Takei H,Suzuki S
    An acyl-CoA-binding protein from grape that is induced through ER stress confers morphological changes and disease resistance in Arabidopsis.
    J. Plant Physiol., 2013. 170(6): p. 591-600
    [PMID:23261264]
  191. Kim SK,Park HY,Jang YH,Lee JH,Kim JK
    The sequence variation responsible for the functional difference between the CONSTANS protein, and the CONSTANS-like (COL) 1 and COL2 proteins, resides mostly in the region encoded by their first exons.
    Plant Sci., 2013. 199-200: p. 71-8
    [PMID:23265320]
  192. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  193. Kim Y, et al.
    ELF4 regulates GIGANTEA chromatin access through subnuclear sequestration.
    Cell Rep, 2013. 3(3): p. 671-7
    [PMID:23523352]
  194. Yamashino T, et al.
    Clock-controlled and FLOWERING LOCUS T (FT)-dependent photoperiodic pathway in Lotus japonicus I: verification of the flowering-associated function of an FT homolog.
    Biosci. Biotechnol. Biochem., 2013. 77(4): p. 747-53
    [PMID:23563564]
  195. Cui X, et al.
    Ubiquitin-specific proteases UBP12 and UBP13 act in circadian clock and photoperiodic flowering regulation in Arabidopsis.
    Plant Physiol., 2013. 162(2): p. 897-906
    [PMID:23645632]
  196. Yeang HY
    Solar rhythm in the regulation of photoperiodic flowering of long-day and short-day plants.
    J. Exp. Bot., 2013. 64(10): p. 2643-52
    [PMID:23645867]
  197. Ando E, et al.
    TWIN SISTER OF FT, GIGANTEA, and CONSTANS have a positive but indirect effect on blue light-induced stomatal opening in Arabidopsis.
    Plant Physiol., 2013. 162(3): p. 1529-38
    [PMID:23669744]
  198. Riboni M,Galbiati M,Tonelli C,Conti L
    GIGANTEA enables drought escape response via abscisic acid-dependent activation of the florigens and SUPPRESSOR OF OVEREXPRESSION OF CONSTANS.
    Plant Physiol., 2013. 162(3): p. 1706-19
    [PMID:23719890]
  199. Endo M,Tanigawa Y,Murakami T,Araki T,Nagatani A
    PHYTOCHROME-DEPENDENT LATE-FLOWERING accelerates flowering through physical interactions with phytochrome B and CONSTANS.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(44): p. 18017-22
    [PMID:24127609]
  200. Liu Y,Liu Q,Yan Q,Shi L,Fang Y
    Nucleolus-tethering system (NoTS) reveals that assembly of photobodies follows a self-organization model.
    Mol. Biol. Cell, 2014. 25(8): p. 1366-73
    [PMID:24554768]
  201. Rosas U, et al.
    Variation in Arabidopsis flowering time associated with cis-regulatory variation in CONSTANS.
    Nat Commun, 2014. 5: p. 3651
    [PMID:24736505]
  202. Hou X, et al.
    Nuclear factor Y-mediated H3K27me3 demethylation of the SOC1 locus orchestrates flowering responses of Arabidopsis.
    Nat Commun, 2014. 5: p. 4601
    [PMID:25105952]
  203. Bu Z, et al.
    Regulation of arabidopsis flowering by the histone mark readers MRG1/2 via interaction with CONSTANS to modulate FT expression.
    PLoS Genet., 2014. 10(9): p. e1004617
    [PMID:25211338]
  204. Wang CQ,Guthrie C,Sarmast MK,Dehesh K
    BBX19 interacts with CONSTANS to repress FLOWERING LOCUS T transcription, defining a flowering time checkpoint in Arabidopsis.
    Plant Cell, 2014. 26(9): p. 3589-602
    [PMID:25228341]
  205. Song YH, et al.
    Distinct roles of FKF1, Gigantea, and Zeitlupe proteins in the regulation of Constans stability in Arabidopsis photoperiodic flowering.
    Proc. Natl. Acad. Sci. U.S.A., 2014. 111(49): p. 17672-7
    [PMID:25422419]
  206. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  207. Zhang B,Wang L,Zeng L,Zhang C,Ma H
    Arabidopsis TOE proteins convey a photoperiodic signal to antagonize CONSTANS and regulate flowering time.
    Genes Dev., 2015. 29(9): p. 975-87
    [PMID:25934507]
  208. Nguyen KT,Park J,Park E,Lee I,Choi G
    The Arabidopsis RING Domain Protein BOI Inhibits Flowering via CO-dependent and CO-independent Mechanisms.
    Mol Plant, 2015. 8(12): p. 1725-36
    [PMID:26298008]
  209. Graeff M, et al.
    MicroProtein-Mediated Recruitment of CONSTANS into a TOPLESS Trimeric Complex Represses Flowering in Arabidopsis.
    PLoS Genet., 2016. 12(3): p. e1005959
    [PMID:27015278]
  210. Putterill J,Robson F,Lee K,Simon R,Coupland G
    The CONSTANS gene of Arabidopsis promotes flowering and encodes a protein showing similarities to zinc finger transcription factors.
    Cell, 1995. 80(6): p. 847-57
    [PMID:7697715]
  211. Yang CH,Chen LJ,Sung ZR
    Genetic regulation of shoot development in Arabidopsis: role of the EMF genes.
    Dev. Biol., 1995. 169(2): p. 421-35
    [PMID:7781888]
  212. Putterill J,Robson F,Lee K,Coupland G
    Chromosome walking with YAC clones in Arabidopsis: isolation of 1700 kb of contiguous DNA on chromosome 5, including a 300 kb region containing the flowering-time gene CO.
    Mol. Gen. Genet., 1993. 239(1-2): p. 145-57
    [PMID:8099710]
  213. Hensel LL,Grbić V,Baumgarten DA,Bleecker AB
    Developmental and age-related processes that influence the longevity and senescence of photosynthetic tissues in arabidopsis.
    Plant Cell, 1993. 5(5): p. 553-64
    [PMID:8518555]
  214. Lagercrantz U,Putterill J,Coupland G,Lydiate D
    Comparative mapping in Arabidopsis and Brassica, fine scale genome collinearity and congruence of genes controlling flowering time.
    Plant J., 1996. 9(1): p. 13-20
    [PMID:8580970]
  215. Simon R,Ige
    Activation of floral meristem identity genes in Arabidopsis.
    Nature, 1996. 384(6604): p. 59-62
    [PMID:8900276]
  216. Bl
    Illuminating flowers: CONSTANS induces LEAFY expression.
    Bioessays, 1997. 19(4): p. 277-9
    [PMID:9136624]
  217. Guo H,Yang H,Mockler TC,Lin C
    Regulation of flowering time by Arabidopsis photoreceptors.
    Science, 1998. 279(5355): p. 1360-3
    [PMID:9478898]
  218. Blazquez MA,Green R,Nilsson O,Sussman MR,Weigel D
    Gibberellins promote flowering of arabidopsis by activating the LEAFY promoter
    Plant Cell, 1998. 10(5): p. 791-800
    [PMID:9596637]
  219. Haung MD,Yang CH
    EMF genes interact with late-flowering genes to regulate Arabidopsis shoot development.
    Plant Cell Physiol., 1998. 39(4): p. 382-93
    [PMID:9615462]
  220. Robert LS,Robson F,Sharpe A,Lydiate D,Coupland G
    Conserved structure and function of the Arabidopsis flowering time gene CONSTANS in Brassica napus.
    Plant Mol. Biol., 1998. 37(5): p. 763-72
    [PMID:9678571]
  221. Song J, et al.
    Isolation and mapping of a family of putative zinc-finger protein cDNAs from rice.
    DNA Res., 1998. 5(2): p. 95-101
    [PMID:9679197]
  222. Moon YH,Chae S,Jung JY,An G
    Expressed sequence tags of radish flower buds and characterization of a CONSTANS LIKE 1 gene.
    Mol. Cells, 1998. 8(4): p. 452-8
    [PMID:9749533]
  223. Levy YY, Dean C
    The transition to flowering
    Plant Cell, 1998. 10(12): p. 1973-90
    [PMID:9836739]